PDB entry 2lbp

View 2lbp on RCSB PDB site
Description: structure of the l-leucine-binding protein refined at 2.4 angstroms resolution and comparison with the leu(slash)ile(slash)val-binding protein structure
Deposited on 1989-04-10, released 1989-07-12
The last revision prior to the SCOP 1.63 freeze date was dated 1989-07-12, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.213
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d2lbp__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lbp_ (-)
    ddikvavvgamsgpiaqwgimefngaeqaikdinakggikgdklvgveyddacdpkqava
    vankivndgikyvighlcssstqpasdiyedegilmispgatapeltqrgyqhimrtagl
    dssqgptaakyiletvkpqriaiihdkqqygeglarsvqdglkaananvvffdgitagek
    dfsaliarlkkenidfvyyggyypemgqmlrqarsvglktqfmgpegvgnaslsniagda
    aegmlvtmpkrydqdpanqgivdalkadkkdpsgpyvwityaavqslatalertgsdepl
    alvkdlkangantvigplnwdekgdlkgfdfgvfqwhadgsstkak