PDB entry 2lbd

View 2lbd on RCSB PDB site
Description: ligand-binding domain of the human retinoic acid receptor gamma bound to all-trans retinoic acid
Deposited on 1997-08-19, released 1997-11-12
The last revision prior to the SCOP 1.55 freeze date was dated 1997-11-12, with a file datestamp of 1997-11-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2lbd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2lbd_ (-)
lspqleelitkvskahqetfpslcqlgkyttnssadhrvqldlglwdkfselatkciiki
vefakrlpgftglsiadqitllkaacldilmlrictrytpeqdtmtfsdgltlnrtqmhn
agfgpltdlvfafagqllplemddtetgllsaiclicgdrmdleepekvdklqeplleal
rlyarrrrpsqpymfprmlmkitdlrgistkgaeraitlkmeipgpmppliremlenp