PDB entry 2lbb

View 2lbb on RCSB PDB site
Description: Solution structure of acyl CoA binding protein from Babesia bovis T2Bo
Class: protein binding
Keywords: acyl CoA binding protein, PROTEIN BINDING, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID
Deposited on 2011-03-29, released 2011-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl CoA binding protein
  Species: Babesia bovis [TaxId:5865]
  Gene: BBOV_IV000490
  Database cross-references and differences (RAF-indexed):
  • Uniprot A7AV23 (8-95)
  Domains in SCOPe 2.08: d2lbba_

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2lbbA (A:)
  mahhhhhhmsaddfdaavkyvsntttmmasnddklcfykyykqatvgdcnkpkpgmlqlq
  ekykweawnalrgmstesakeayvklldtlapswrn
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2lbbA (A:)
  msaddfdaavkyvsntttmmasnddklcfykyykqatvgdcnkpkpgmlqlqekykweaw
  nalrgmstesakeayvklldtlapswrn