PDB entry 2lal

View 2lal on RCSB PDB site
Description: crystal structure determination and refinement at 2.3 angstroms resolution of the lentil lectin
Class: lectin
Keywords: lectin
Deposited on 1993-06-10, released 1993-10-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.189
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lentil lectin (alpha chain)
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2lal.1
  • Chain 'B':
    Compound: lentil lectin (beta chain)
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2lal.1
  • Chain 'C':
    Compound: lentil lectin (alpha chain)
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2lal.2
  • Chain 'D':
    Compound: lentil lectin (beta chain)
    Species: Lens culinaris
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2lal.2
  • Heterogens: PO4, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lalA (A:)
    tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
    anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
    dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2lalB (B:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlghtsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lalB (B:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2lalC (C:)
    tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
    anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
    dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
    n
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2lalD (D:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlghtsks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2lalD (D:)
    vtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg