PDB entry 2l9c

View 2l9c on RCSB PDB site
Description: Structural insights into the specificity of darcin, an atypical major urinary protein.
Class: transport protein
Keywords: male specific protein, lipocalin, TRANSPORT PROTEIN, Darcin, MUP, major urinary protein, MUP20
Deposited on 2011-02-07, released 2012-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Darcin
  Species: Mus musculus [TaxId:10090]
  Gene: Mup20, Mup24, Q5FW60
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5FW60 (14-175)
    • expression tag (0-13)
  Domains in SCOPe 2.08: d2l9ca1, d2l9ca2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l9cA (A:)
  mgsshhhhhhiegreeassmernfnvekingewytimlatdkrekieehgsmrvfveyih
  vlenslalkfhiiineecseiflvadktekageysvtydgsntftilktdydnyimihli
  nkkdgetfqlmelygrepdlssdikekfaqlseehgivreniidltnanrcleare