PDB entry 2l8d

View 2l8d on RCSB PDB site
Description: Structure/function of the LBR Tudor domain
Class: DNA binding protein
Keywords: DNA binding protein
Deposited on 2011-01-10, released 2011-11-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-01-25, with a file datestamp of 2012-01-20.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lamin-B receptor
  Species: Gallus gallus [TaxId:9031]
  Gene: LBR
  Database cross-references and differences (RAF-indexed):
  • Uniprot P23913 (4-65)
    • expression tag (0-3)
  Domains in SCOPe 2.06: d2l8da1, d2l8da2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l8dA (A:)
  gamgmpnrkyadgevvmgrwpgsvlyyevqvtsyddashlytvkykdgtelalkesdirl
  qssfkq