PDB entry 2l8a

View 2l8a on RCSB PDB site
Description: Structure of a novel CBM3 lacking the calcium-binding site
Class: hydrolase
Keywords: carbohydrate-binding module, family 3, HYDROLASE
Deposited on 2011-01-07, released 2011-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: eglS, bglC, gld, BSU18130
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10475 (3-148)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d2l8aa1, d2l8aa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l8aA (A:)
    masisvqyragdgsmnsnqirpqlqiknngnttvdlkdvtarywykaknkgqnfdcdyaq
    igcgnvthkfvtlhkpkqgadtylelgfkngtlapgastgniqlrlhnddwsnyaqsgdy
    sffksntfkttkkitlydqgkliwgtepn