PDB entry 2l7z

View 2l7z on RCSB PDB site
Description: NMR Structure of A13 homedomain
Class: gene regulation
Keywords: hoxa13, gene regulation
Deposited on 2010-12-27, released 2011-11-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein Hox-A13
    Species: Homo sapiens [TaxId:9606]
    Gene: HOXA13, HOX1J
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31271 (6-72)
      • expression tag (0-5)
    Domains in SCOPe 2.08: d2l7za1, d2l7za2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l7zA (A:)
    mshmlegrkkrvpytkvqlkelereyatnkfitkdkrrrisattnlserqvtiwfqnrrv
    kekkvinklktts