PDB entry 2l7r

View 2l7r on RCSB PDB site
Description: Solution NMR structure of N-terminal Ubiquitin-like domain of FUBI, a ribosomal protein S30 precursor from Homo sapiens. NorthEast Structural Genomics consortium (NESG) target HR6166
Class: protein binding
Keywords: Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, PROTEIN BINDING, SGC
Deposited on 2010-12-20, released 2011-01-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like protein FUBI
    Species: Homo sapiens [TaxId:9606]
    Gene: FAU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2l7ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2l7rA (A:)
mgsshhhhhhssglvprgsmqlfvraqelhtfevtgqetvaqikahvaslegiapedqvv
llagapledeatlgqcgvealttlevagrmlgg

    Sequence, based on observed residues (ATOM records): (download) 
    >2l7rA (A:)
mqlfvraqelhtfevtgqetvaqikahvaslegiapedqvvllagapledeatlgqcgve
alttlevagrmlgg