PDB entry 2l7f

View 2l7f on RCSB PDB site
Description: Solution Structure of the Pitx2 Homeodomain
Class: transcription
Keywords: Pitx2, Homeodomain, DNA-binding, TRANSCRIPTION
Deposited on 2010-12-08, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'P':
    Compound: Pituitary homeobox 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PITX2, ARP1, RGS, RIEG, RIEG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99697 (2-61)
      • expression tag (0-1)
      • see remark 999 (62-67)
    Domains in SCOPe 2.07: d2l7fp1, d2l7fp2

PDB Chain Sequences:

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l7fP (P:)
    gsqrrqrthftsqqlqeleatfqrnrypdmstreeiavwtnltearvrvwfknrrakwrk
    reefivtd