PDB entry 2l78

View 2l78 on RCSB PDB site
Description: design and structural analysis of alternative hydrophobic core packing arrangements in bacteriophage t4 lysozyme
Deposited on 1992-01-22, released 1993-04-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-04-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.159
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2l78__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l78_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgiagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk