PDB entry 2l74

View 2l74 on RCSB PDB site
Description: Solution structure of the PilZ domain protein PA4608 complex with c-di-GMP identifies charge clustering as molecular readout
Class: c-di-GMP binding protein
Keywords: PilZ, PA4608, c-di-GMP, Unknown Function, c-di-GMP binding protein
Deposited on 2010-12-02, released 2011-02-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein PA4608
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA4608
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2l74a_
  • Heterogens: C2E

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2l74A (A:)
    mgsshhhhhhssglvprgshmsdqhderrrfhriafdadseilqgerrwevllhdvslhg
    ilvgqpqdwngdpqrpfearlylgldvlirmeislawardgllgfecqhidldsishlrr
    lvelnlgdeellerelallvsahdd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2l74A (A:)
    msdqhderrrfhriafdadseilqgerrwevllhdvslhgilvgqpqdwngdpqrpfear
    lylgldvlirmeislawardgllgfecqhidldsishlrrlvelnlgdeellerelallv
    sahdd