PDB entry 2l72

View 2l72 on RCSB PDB site
Description: Solution structure and dynamics of ADF from Toxoplasma gondii (TgADF)
Class: protein binding
Keywords: ADF/cofilin, TgADF, Actin binding, protein binding
Deposited on 2010-12-01, released 2011-08-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-12-28, with a file datestamp of 2011-12-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin depolymerizing factor, putative
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2l72a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2l72A (A:)
mghhhhhhhhhhssghiegrhmasgmgvdencvarfnelkirktvkwivfkientkivve
kdgkgnadefrgalpandcrfgvydcgnkiqfvlwcpdnapvkprmtyasskdallkkld
gatavaleahemgdlapla

    Sequence, based on observed residues (ATOM records): (download) 
    >2l72A (A:)
masgmgvdencvarfnelkirktvkwivfkientkivvekdgkgnadefrgalpandcrf
gvydcgnkiqfvlwcpdnapvkprmtyasskdallkkldgatavaleahemgdlapla