PDB entry 2l65

View 2l65 on RCSB PDB site
Description: HADDOCK calculated model of the complex of the resistance protein CalC and Calicheamicin-Gamma
Class: Structural genomics, Unknown function
Keywords: Resistance Protein, Structural Genomics, PSI-1, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, Unknown function
Deposited on 2010-11-15, released 2011-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalC
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: CalC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2l65a1
  • Heterogens: DSR, HIB, MRP, MTC

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l65A (A:)
    nydpfvrhsvtvkadrktafktflegfpewwpnnfrttkvgaplgvdkkggrwyeideqg
    eehtfglirkvdepdtlvigwrlngfgridpdnsseftvtfvadgqkktrvdvehthfdr
    mgtkhakrvrngmdkgwptilqsfqdkideegakk