PDB entry 2l5t

View 2l5t on RCSB PDB site
Description: Solution NMR structure of E2 lipoyl domain from Thermoplasma acidophilum
Class: transferase
Keywords: E2 lipoyl domain, Thermoplasma acidophilum, TRANSFERASE
Deposited on 2010-11-05, released 2011-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoamide acyltransferase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta1436
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2l5ta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l5tA (A:)
myefklpdigegvtegeivrwdvkegdmvekdqdlvevmtdkvtvkipspvrgkivkily
regqvvpvgstllqidt