PDB entry 2l59

View 2l59 on RCSB PDB site
Description: Solution Structures of Oxidized and Reduced Thioredoxin C from M. tb
Class: oxidoreductase
Keywords: Trx, M. tb, Tuberculosis, TrxC, OXIDOREDUCTASE
Deposited on 2010-10-28, released 2011-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-03, with a file datestamp of 2013-03-29.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioredoxin
  Species: Mycobacterium tuberculosis [TaxId:1773]
  Gene: trxA, trx, trxC, Rv3914, MT4033, MTV028.05
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A616 (0-115)
  Domains in SCOPe 2.08: d2l59a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l59A (A:)
  mtdseksatikvtdasfatdvlssnkpvlvdfwatwcgpckmvapvleeiateratdltv
  akldvdtnpetarnfqvvsiptlilfkdgqpvkrivgakgkaallrelsdvvpnln