PDB entry 2l54

View 2l54 on RCSB PDB site
Description: Solution structure of the Zalpha domain mutant of ADAR1 (N43A,Y47A)
Class: hydrolase
Keywords: hydrolase
Deposited on 2010-10-24, released 2011-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific adenosine deaminase
    Species: Homo sapiens [TaxId:9606]
    Gene: ADAR, ADAR1, DSRAD, G1P1, IFI4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55265 (0-62)
      • engineered mutation (37)
      • engineered mutation (41)
    Domains in SCOPe 2.07: d2l54a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l54A (A:)
    yqdqeqrilkfleelgegkattahdlsgklgtpkkeiarvlaslakkgklqkeagtpplw
    kia