PDB entry 2l51

View 2l51 on RCSB PDB site
Description: Solution structure of calcium bound S100A16
Class: metal binding protein
Keywords: metal binding protein, Ca(II)S100A16, EF-hand protein, S100 protein
Deposited on 2010-10-22, released 2010-11-03
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A16
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A16, S100F, AAG13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2l51a_
  • Chain 'B':
    Compound: Protein S100-A16
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A16, S100F, AAG13
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2l51b_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l51A (A:)
    sdcytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadk
    liqnldanhdgrisfdeywtliggitgpiakliheqeqqsss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l51B (B:)
    sdcytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadk
    liqnldanhdgrisfdeywtliggitgpiakliheqeqqsss