PDB entry 2l51
View 2l51 on RCSB PDB site
Description: Solution structure of calcium bound S100A16
Class: metal binding protein
Keywords: metal binding protein, Ca(II)S100A16, EF-hand protein, S100 protein
Deposited on
2010-10-22, released
2010-11-03
The last revision prior to the SCOPe 2.08 freeze date was dated
2020-02-05, with a file datestamp of
2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Protein S100-A16
Species: Homo sapiens [TaxId:9606]
Gene: S100A16, S100F, AAG13
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2l51a_ - Chain 'B':
Compound: Protein S100-A16
Species: Homo sapiens [TaxId:9606]
Gene: S100A16, S100F, AAG13
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d2l51b_ - Heterogens: CA
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2l51A (A:)
sdcytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadk
liqnldanhdgrisfdeywtliggitgpiakliheqeqqsss
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2l51B (B:)
sdcytelekavivlvenfykyvskyslvknkiskssfremlqkelnhmlsdtgnrkaadk
liqnldanhdgrisfdeywtliggitgpiakliheqeqqsss