PDB entry 2l4x

View 2l4x on RCSB PDB site
Description: Solution Structure of apo-IscU(WT)
Class: metal transport
Keywords: IscU, iron-sulfur cluster, iron-sulfur cluster scaffold, METAL TRANSPORT
Deposited on 2010-10-19, released 2011-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-26, with a file datestamp of 2012-09-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-sulfur cluster assembly scaffold protein
    Species: Escherichia coli [TaxId:83333]
    Gene: iscU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2l4xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l4xA (A:)
maysekvidhyenprnvgsfdnndenvgsgmvgapacgdvmklqikvndegiiedarfkt
ygcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiad
ykskreak