PDB entry 2l4b

View 2l4b on RCSB PDB site
Description: Solution structure of a putative acyl carrier protein from Anaplasma phagocytophilum. Seattle Structural Genomics Center for Infectious Disease target AnphA.01018.a
Class: transferase
Keywords: infectious disease, Human granulocytic anaplasmosis, SSGCID, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, TRANSFERASE
Deposited on 2010-10-02, released 2010-11-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Anaplasma phagocytophilum [TaxId:212042]
  Gene: APH_0929
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q2GJE9 (5-87)
    • expression tag (0-4)
  Domains in SCOPe 2.06: d2l4ba1, d2l4ba2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l4bA (A:)
  pgsmvseeikaqvmesvigclklndeqkqilsgttnlakdfnldsldfvdlimsleerfs
  leisdedaqkletvddicryiaskssda