PDB entry 2l3x

View 2l3x on RCSB PDB site
Description: villin head piece domain of human ABLIM2
Class: protein binding
Keywords: actin binding, PROTEIN BINDING
Deposited on 2010-09-24, released 2011-09-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ABLIM2 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ABLIM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2l3xa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l3xA (A:)
qykiypydslivtnrirvklpkdvdrtrlerhlspeefqevfgmsieefdrlalwkrndl
kkkallf