PDB entry 2l3g

View 2l3g on RCSB PDB site
Description: Solution NMR Structure of CH domain of Rho guanine nucleotide exchange factor 7 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4495E
Class: signaling protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-biology, calponin-homology domain, Protein Structure Initiative, SIGNALING PROTEIN
Deposited on 2010-09-13, released 2010-12-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho guanine nucleotide exchange factor 7
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGEF7, COOL1, KIAA0142, P85SPR, PAK3BP, PIXB, Nbla10314
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14155 (10-125)
      • expression tag (0-9)
    Domains in SCOPe 2.08: d2l3ga1, d2l3ga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l3gA (A:)
mghhhhhhshmnsaeqtvtwlitlgvlespkktisdpegflqaslkdgvvlcrllerllp
gtiekvypeprseseclsnireflrgcgaslrletfdandlyqgqnfnkvlsslvtlnkv
tadigl