PDB entry 2l3d

View 2l3d on RCSB PDB site
Description: The solution structure of the short form SWIRM domain of LSD1
Class: Transcription
Keywords: LSD1, SWIRM, Transcription
Deposited on 2010-09-13, released 2011-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysine-specific histone demethylase 1A
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O60341 (2-101)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d2l3da1, d2l3da2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l3dA (A:)
  gsvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqltf
  eatlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl