PDB entry 2l39

View 2l39 on RCSB PDB site
Description: Mouse prion protein fragment 121-231 AT 37 C
Class: membrane protein
Keywords: prion, conformational exchange, MEMBRANE PROTEIN
Deposited on 2010-09-10, released 2011-08-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-09, with a file datestamp of 2011-11-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, RP23-401J24.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4FJQ7 (2-113)
      • see remark 999 (0-1)
    Domains in SCOPe 2.05: d2l39a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l39A (A:)
    gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
    cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss