PDB entry 2l38

View 2l38 on RCSB PDB site
Description: R29Q Sticholysin II mutant
Class: toxin
Keywords: Actinoporin, Sticholysin, Pore forming toxin, TOXIN
Deposited on 2010-09-10, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sticholysin-2
    Species: Stichodactyla helianthus [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07845 (0-174)
      • engineered mutation (28)
    Domains in SCOPe 2.07: d2l38a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l38A (A:)
alagtiiagasltfqvldkvleelgkvsqkiavgidnesggtwtalnayfrsgttdvilp
efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwysnwwdvkiy
sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr