PDB entry 2l2s

View 2l2s on RCSB PDB site
Description: Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with 1-{[(4-methylphenyl)thio]acetyl}piperidine
Class: isomerase
Keywords: cis-trans isomerase, FKBP, complex, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SGC, SSGCID, ISOMERASE
Deposited on 2010-08-27, released 2010-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: peptidyl-prolyl cis-trans isomerase
  Species: Burkholderia pseudomallei [TaxId:28450]
  Gene: BURPS1710b_A0907
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3JK38 (4-116)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d2l2sa1, d2l2sa2
• Heterogens: L2S

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l2sA (A:)
  gpgsmtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafv
  lgggmvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv