PDB entry 2l2c

View 2l2c on RCSB PDB site
Description: NMR Structure of mosquito odorant binding protein bound to MOP pheromone
Class: transport protein
Keywords: pheromone binding protein, TRANSPORT PROTEIN
Deposited on 2010-08-16, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: odorant-binding protein
    Species: Culex quinquefasciatus [TaxId:7176]
    Gene: CpipJ_CPIJ007604
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8T6I2 (0-124)
      • see remark 999 (76)
    Domains in SCOPe 2.07: d2l2ca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l2cA (A:)
    dvtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfh
    eakvvddngdvhleklrdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpk
    hyflv