PDB entry 2l2c

View 2l2c on RCSB PDB site
Description: NMR Structure of mosquito odorant binding protein bound to MOP pheromone
Class: transport protein
Keywords: pheromone binding protein, TRANSPORT PROTEIN
Deposited on 2010-08-16, released 2011-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: odorant-binding protein
  Species: Culex quinquefasciatus [TaxId:7176]
  Gene: CpipJ_CPIJ007604
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8T6I2 (0-124)
    • see remark 999 (76)
  Domains in SCOPe 2.06: d2l2ca_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l2cA (A:)
  dvtprrdaeypppellealkplhdicakktgvtdeaiiefsdgkihedeklkcymnclfh
  eakvvddngdvhleklrdslpnsmhdiamhmgkrclypegenlcekafwlhkcwkqadpk
  hyflv