PDB entry 2l2b

View 2l2b on RCSB PDB site
Description: Structure of StnII-Y111N, a mutant of the sea anemone actinoporin Sticholysin II
Class: toxin
Keywords: actinoporin sticholysin variant, Pore forming toxin, TOXIN
Deposited on 2010-08-16, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sticholysin-2
    Species: Stichodactyla helianthus [TaxId:6123]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07845 (0-174)
      • engineered mutation (110)
    Domains in SCOPe 2.07: d2l2ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l2bA (A:)
    alagtiiagasltfqvldkvleelgkvsrkiavgidnesggtwtalnayfrsgttdvilp
    efvpntkallysgrkdtgpvatgavaafayymssgntlgvmfsvpfdynwnsnwwdvkiy
    sgkrradqgmyedlyygnpyrgdngwheknlgyglrmkgimtsageakmqikisr