PDB entry 2l29
View 2l29 on RCSB PDB site
Description: Complex structure of E4 mutant human IGF2R domain 11 bound to IGF-II
Class: transport protein
Keywords: mannose 6 phosphate receptor, Insulin-like growth factor 2, Genomic imprinting, ligand trap, TRANSPORT PROTEIN
Deposited on
2010-08-13, released
2012-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated
2012-12-12, with a file datestamp of
2012-12-07.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Insulin-like growth factor 2 receptor variant
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q59EZ3 (0-139)
- engineered mutation (36-37)
- engineered mutation (39)
- expression tag (140-141)
Domains in SCOPe 2.07: d2l29a1, d2l29a2 - Chain 'B':
Compound: insulin-like growth factor II
Species: Homo sapiens [TaxId:9606]
Gene: IGF2, PP1446
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d2l29b_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2l29A (A:)
mksnehddcqvtnpstghlfdlsslsgragftaaysksgvvymsicgenencppgvgacf
gqtrisvgkankrlryvdqvlqlvykdgspcpsksglsyksvisfvcrpeagptnrpmli
sldkqtctlffswhtplacepe
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2l29B (B:)
ayrpsetlcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletyc
atpakse