PDB entry 2l1h

View 2l1h on RCSB PDB site
Description: Mouse prion protein fragment 121-231 at 20 C
Class: membrane protein
Keywords: prion, MEMBRANE PROTEIN
Deposited on 2010-07-28, released 2011-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-01, with a file datestamp of 2012-01-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major prion protein
    Species: Mus musculus [TaxId:10090]
    Gene: Prnp, RP23-401J24.1-001
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4FJQ7 (2-113)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2l1ha1, d2l1ha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l1hA (A:)
gsvvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvdqysnqnnfvhd
cvnitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss