PDB entry 2l1g

View 2l1g on RCSB PDB site
Description: RDC refined solution structure of the THAP zinc finger of THAP1 in complex with its 16bp RRM1 DNA target
Class: Transcription/DNA
Keywords: Zinc finger, Protein-DNA complex, DNA binding domain, Transcription factor, CCCH, Transcription-DNA complex
Deposited on 2010-07-28, released 2010-09-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: THAP domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NVV9 (0-81)
      • engineered mutation (61)
      • engineered mutation (66)
      • expression tag (82-86)
    Domains in SCOPe 2.04: d2l1ga_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*cp*tp*tp*gp*tp*gp*tp*gp*gp*gp*cp*ap*gp*cp*g)-3')
  • Chain 'C':
    Compound: DNA (5'-d(p*cp*gp*cp*tp*gp*cp*cp*cp*ap*cp*ap*cp*ap*ap*gp*c)-3')
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l1gA (A:)
mvqscsaygcknrydkdkpvsfhkfpltrpslckeweaavrrknfkptkyssicsehftp
dsfkresnnkllkenavptiflelvpr

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.