PDB entry 2l0x

View 2l0x on RCSB PDB site
Description: Solution structure of the 21 kDa GTPase RHEB bound to GDP
Class: hydrolase
Keywords: gtpase, hydrolase
Deposited on 2010-07-19, released 2010-08-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-11-10, with a file datestamp of 2010-11-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding protein Rheb
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Rheb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2l0xa_
  • Heterogens: MG, GDP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l0xA (A:)
srkiailgyrsvgkssltiqfvegqfvdsydptientftklitvngqeyhlqlvdtagqd
eysifpqtysidingyilvysvtsiksfevikvihgklldmvgkvqipimlvgnkkdlhm
ervisyeegkalaeswnaaflessakenqtavdvfrriileaekidgaa