PDB entry 2l0s

View 2l0s on RCSB PDB site
Description: Solution Structure of Human Plasminogen Kringle 3
Class: blood clotting
Keywords: Plasminogen, Kringle Domain, SERINE PROTEASE, FIBRINOLYSIS, BLOOD CLOTTING
Deposited on 2010-07-15, released 2010-08-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Gene: PLG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00747 (0-82)
      • engineered mutation (44)
    Domains in SCOPe 2.08: d2l0sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l0sA (A:)
    tyqclkgtgenyrgnvavtvsghtcqhwsaqtphthnrtpenfpsknldenycrnpdgkr
    apwchttnsqvrweyckipscds