PDB entry 2l0q

View 2l0q on RCSB PDB site
Description: NMR Solution Structure of Vibrio harveyi Acyl Carrier Protein (ACP)
Class: lipid binding protein
Keywords: acyl carrier protein, fatty acid biosynthesis, acyl chain binding, lipid binding protein
Deposited on 2010-07-12, released 2010-07-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-11-24, with a file datestamp of 2010-11-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Vibrio harveyi 1DA3 [TaxId:673519]
  Gene: acpP, VME_27770
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0XCG4 (4-79)
    • expression tag (0-3)
    • engineered mutation (78)
  Domains in SCOPe 2.08: d2l0qa1, d2l0qa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l0qA (A:)
  giplsnieervkkiiveqlgvdeaevkneasfvddlgadsldtvelvmaleeefdteipd
  eeaekittvqaaidyvnshq