PDB entry 2l0a

View 2l0a on RCSB PDB site
Description: Solution NMR Structure of Signal transducing adapter molecule 1 STAM-1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4479E
Class: signaling protein
Keywords: Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-2, Protein Structure Initiative, SIGNALING PROTEIN
Deposited on 2010-06-30, released 2010-07-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-07-21, with a file datestamp of 2010-07-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Signal transducing adapter molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: STAM, STAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92783 (11-71)
      • expression tag (0-10)
      • engineered mutation (16)
    Domains in SCOPe 2.04: d2l0aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2l0aA (A:)
mghhhhhhshmnhqhearkvraiydfeaaedneltfkageiitvlddsdpnwwkgethqg
iglfpsnfvtad