PDB entry 2l08

View 2l08 on RCSB PDB site
Description: Solution NMR Structure of Nonsense mRNA reducing factor 3A from H. Sapiens, Northeast Structural Genomics Consortium Target HR4714B
Class: transport protein
Keywords: NESG, Nonsense regulator, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, TRANSPORT PROTEIN
Deposited on 2010-06-30, released 2010-08-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulator of nonsense transcripts 3A
  Species: Homo sapiens [TaxId:9606]
  Gene: UPF3A, RENT3A, UPF3
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H1J1 (11-96)
    • expression tag (0-10)
  Domains in SCOPe 2.04: d2l08a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2l08A (A:)
  mghhhhhhshmvvirrlppgltkeqleeqlrplpahdyfeffaadlslyphlysrayinf
  rnpddillfrdrfdgyifldskgleypavvefapfqk