PDB entry 2l08

View 2l08 on RCSB PDB site
Description: Solution NMR Structure of Nonsense mRNA reducing factor 3A from H. Sapiens, Northeast Structural Genomics Consortium Target HR4714B
Class: transport protein
Keywords: NESG, Nonsense regulator, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, TRANSPORT PROTEIN
Deposited on 2010-06-30, released 2010-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of nonsense transcripts 3A
    Species: Homo sapiens [TaxId:9606]
    Gene: UPF3A, RENT3A, UPF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H1J1 (11-96)
      • expression tag (0-10)
    Domains in SCOPe 2.08: d2l08a1, d2l08a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2l08A (A:)
    mghhhhhhshmvvirrlppgltkeqleeqlrplpahdyfeffaadlslyphlysrayinf
    rnpddillfrdrfdgyifldskgleypavvefapfqk