PDB entry 2kzt

View 2kzt on RCSB PDB site
Description: Structure of the Tandem MA-3 Region of Pdcd4
Class: Apoptosis
Keywords: Pdcd4, MA-3, eIF4A, HEAT, Apoptosis
Deposited on 2010-06-24, released 2011-03-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-23, with a file datestamp of 2011-11-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Programmed cell death protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53EL6 (1-162)
      • expression tag (0)
  • Chain 'B':
    Compound: Programmed cell death protein 4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2kztb_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kztB (B:)
    ggqqpvnhlvkeidmllkeyllsgdiseaehclkelevphfhhelvyeaivmvlestges
    afkmildllkslwksstitidqmkrgyeriyneipdinldvphsysvlerfveecfqagi
    iskqlrdlcps