PDB entry 2kzf

View 2kzf on RCSB PDB site
Description: Solution NMR structure of the thermotoga maritima protein TM0855 a putative ribosome binding factor A
Class: ribosomal protein
Keywords: JCSG, Joint Center Structural Genomics, Protein Structure Initiative, Joint Center for Structural Genomics, PSI, RIBOSOMAL PROTEIN
Deposited on 2010-06-16, released 2010-08-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-03-20, with a file datestamp of 2013-03-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome-binding factor a
    Species: Thermotoga maritima [TaxId:2336]
    Gene: rbfA, TM_0855
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZV9 (1-105)
      • expression tag (0)
    Domains in SCOPe 2.08: d2kzfa1, d2kzfa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kzfA (A:)
gmnpayrkamleseiqkllmealqqlrdprlkkdfvtfsrvelskdkryadvyvsflgtp
eerketveilnrakgffrtfiaknlrlyvapeirfyedkgieasvk