PDB entry 2kyx

View 2kyx on RCSB PDB site
Description: Solution structure of the RRM domain of CYP33
Class: isomerase
Keywords: cyp33, rrm, isomerase
Deposited on 2010-06-09, released 2010-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidyl-prolyl cis-trans isomerase e
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIE, CYP33
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UNP9 (2-82)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d2kyxa1, d2kyxa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kyxA (A:)
    gsttkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
    aaaidnmneselfgrtirvnlak