PDB entry 2kys

View 2kys on RCSB PDB site
Description: NMR Structure of the SARS Coronavirus Nonstructural Protein Nsp7 in Solution at pH 6.5
Class: viral protein
Keywords: severe acute respiratory syndrome (SARS), coronavirus, nsp7, conformational polymorphism, Structural Genomics, PSI-2, Protein Structure Initiative, Joint Center for Structural Genomics, JCSG, VIRAL PROTEIN
Deposited on 2010-06-07, released 2010-06-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Non-structural protein 7
  Species: SARS coronavirus [TaxId:227859]
  Gene: 1a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0C6U8 (2-84)
    • expression tag (0-1)
  Domains in SCOPe 2.06: d2kysa1, d2kysa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kysA (A:)
  ghskmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsv
  llsmqgavdinrlceemldnratlq