PDB entry 2kyq

View 2kyq on RCSB PDB site
Description: 1H, 15N, 13C chemical shifts and structure of CKR-brazzein
Class: plant protein
Keywords: sweet-tasting protein, plant protein
Deposited on 2010-06-07, released 2011-05-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-30, with a file datestamp of 2011-11-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Defensin-like protein
    Species: Pentadiplandra brazzeana [TaxId:43545]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56552 (0-52)
      • engineered mutation (1-3)
    Domains in SCOPe 2.05: d2kyqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2kyqA (A:)
    dckrkvyenypvskcqlanqcnydckldkharsgecfydekrnlqcicdycey