PDB entry 2kyk

View 2kyk on RCSB PDB site
Description: The sandwich region between two LMP2A PY motif regulates the interaction between AIP4WW2domain and PY motif
Class: ligase
Keywords: LMP2A, PY motif, Ubiquitin-protein ligase, WW domain, LIGASE
Deposited on 2010-05-28, released 2011-06-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-06-01, with a file datestamp of 2011-05-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: E3 ubiquitin-protein ligase Itchy homolog
  Species: Homo sapiens [TaxId:9606]
  Gene: ITCH
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96J02 (5-38)
    • expression tag (0-4)
  Domains in SCOPe 2.06: d2kyka1, d2kyka2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kykA (A:)
  gramgplppgwerrvdnmgriyyvdhftrtttwqrptle