PDB entry 2kyh

View 2kyh on RCSB PDB site
Description: Solution structure of the voltage-sensing domain of KvAP
Class: membrane protein
Keywords: Ion channel, MEMBRANE PROTEIN
Deposited on 2010-05-26, released 2010-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-gated potassium channel
    Species: Aeropyrum pernix [TaxId:56636]
    Gene: APE_0955
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9YDF8 (0-142)
      • see remark 999 (0)
      • expression tag (143-146)
    Domains in SCOPe 2.08: d2kyha1, d2kyha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2kyhA (A:)
lrglsdlggrvrnigdvmehplvelgvsyaallsvivvvveytmqlsgeylvrlylvdli
lviilwadyayrayksgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrf
lrilliisrgskflsaiadaadklvpr