PDB entry 2ky8

View 2ky8 on RCSB PDB site
Description: Solution structure and dynamic analysis of chicken MBD2 methyl binding domain bound to a target methylated DNA sequence
Class: transcription/DNA
Keywords: DNA Binding domain, TRANSCRIPTION-DNA complex
Deposited on 2010-05-18, released 2011-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-07, with a file datestamp of 2011-09-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyl-CpG-binding domain protein 2
    Species: Gallus gallus [TaxId:9031]
    Gene: MBD2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2ky8a_
  • Chain 'B':
    Compound: DNA (5'-d(*gp*gp*ap*ap*tp*(5cm)p*gp*gp*cp*(ted)p*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*ap*gp*cp*(5cm)p*gp*ap*tp*(ted)p*cp*c)-3')
  • Heterogens: MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ky8A (A:)
    gsdkqgrtdcpalppgwkkeevirksglsagksdvyyfspsgkkfrskpqlarylgnavd
    lscfdfrtgkmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ky8A (A:)
    dkqgrtdcpalppgwkkeevirksglsagksdvyyfspsgkkfrskpqlarylgnavdls
    cfdfrtgkmm
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.