PDB entry 2ky3

View 2ky3 on RCSB PDB site
Description: Solution structure of GS-alfa-Ktx5.4 synthetic scorpion like
Class: toxin
Keywords: alpha/beta scaffold, beta sheet, alpha helix, scoprion K+ toxin, GS-alpha-Ktx5.4, aKtx5.4, Mesobuthus tamulus, potassium blocker, TOXIN
Deposited on 2010-05-14, released 2011-06-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium channel toxin alpha-KTx 5.4
    Species: Mesobuthus tamulus [TaxId:34647]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P59869 (2-32)
      • expression tag (0-1)
    Domains in SCOPe 2.05: d2ky3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2ky3A (A:)
    gsafcnlrrcelscrslgllgkcigeeckcvpy