PDB entry 2kxc

View 2kxc on RCSB PDB site
Description: 1H, 13C, and 15N Chemical Shift Assignments for IRTKS-SH3 and EspFu-R47 complex
Class: protein binding
Keywords: IRTKS-SH3, EspFu, Complex Structure, PROTEIN BINDING
Deposited on 2010-04-30, released 2010-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: BAIAP2L1, IRTKS
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UHR4 (3-66)
    • expression tag (0-2)
  Domains in SCOPe 2.08: d2kxca1, d2kxca2
• Chain 'B':
  Compound: EspF-like protein
  Species: Escherichia coli [TaxId:83334]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8X2D5

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kxcA (A:)
  gshmkkqkvktifphtagsnktllsfaqgdvitllipeekdgwlygehdvskargwfpss
  ytkllee
  

  
  
• Chain 'B':
  No sequence available.