PDB entry 2kwl

View 2kwl on RCSB PDB site
Description: Solution Structure of acyl carrier protein from Borrelia burgdorferi
Class: lipid binding protein
Keywords: acyl carrier protein, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, LIPID BINDING PROTEIN
Deposited on 2010-04-12, released 2010-04-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-09-21, with a file datestamp of 2011-09-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Acyl carrier protein
  Species: Borrelia burgdorferi [TaxId:139]
  Gene: acpP, BB_0704
  Database cross-references and differences (RAF-indexed):
  • Uniprot O51647 (4-83)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d2kwla1, d2kwla2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2kwlA (A:)
  gpgsmdndeifskvrsiiseqldkkedeittdsrfvedlnadsldiyellylleeafddk
  ipeneanefetvgdvvnfikkrkg